Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-1/CCL14, Human (HEK293, His)

HCC-1/CCL14 Protein, Human (HEK293, His) is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human (HEK293, His) is a recombinant human HCC-1/CCL14 (T20-N93) expressed by HEK293 with a his tag[1][2].

Product Specifications

Product Name Alternative

HCC-1/CCL14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-1-ccl14-protein-human-hek293-his.html

Purity

95.34

Smiles

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENHHHHHH

Molecular Formula

6358 (Gene_ID) Q16627-1 (T20-N93) (Accession)

Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Yurong Gu, et al. CCL14 is a prognostic biomarker and correlates with immune infiltrates in hepatocellular carcinoma. Aging (Albany NY) . 2020 Jan 12;12 (1) :784-807.|[2]Siyao Wang, et al. Glycosylation Regulates N-Terminal Proteolysis and Activity of the Chemokine CCL14. ACS Chem Biol. 2021 Jun 18;16 (6) :973-981.|[3]Mengxuan Zhu, et al. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis. Cell Death Dis. 2019 Oct 22;10 (11) :796.|[4]Natalie J Hannan, et al. CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation. Biol Reprod. 2008 Jul;79 (1) :58-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human caspase activated deoxyribonuclease,CAD ELISA Kit
CN-04642H1 96T

Human caspase activated deoxyribonuclease,CAD ELISA Kit

Sign In for Pricing
View Details
Cacna2d4 Antibody - middle region : HRP (ARP59812_P050-HRP)
ARP59812_P050-HRP 100 µL

Cacna2d4 Antibody - middle region : HRP (ARP59812_P050-HRP)

Sign In for Pricing
View Details
Fam25a sgRNA CRISPR Lentivector set (Rat)
K6561501 3x 1.0 µg

Fam25a sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Filaggrin 2 (m) -PR
sc-145182-PR 10 µM - 20 µL

Filaggrin 2 (m) -PR

Sign In for Pricing
View Details
Human Diamine acetyltransferase 1 (SAT1)
CSB-RP027594h-01 10 µg

Human Diamine acetyltransferase 1 (SAT1)

Sign In for Pricing
View Details
Human Diamine acetyltransferase 1 (SAT1)
CSB-RP027594h-02 50 µg

Human Diamine acetyltransferase 1 (SAT1)

Sign In for Pricing
View Details