Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Keratinocyte proline-rich protein (Kprp)

Product Specifications

Abbreviation

Recombinant Mouse Kprp protein

Gene Name

Kprp

UniProt

B2RUR4

Expression Region

1-657aa

Organism

Mus musculus (Mouse)

Target Sequence

MCDQQPIQCCVPIPQCCVKGSSFGPSQFSYANNQVLVEAPCEMKVLECAAPCPVQVSQTACQSSTTEVKGQAPCKTTKGKCQAPCQSKTTQVKYQPKTTEIKCQAPCQTQVSCVQCQAPCQSQVSYVQIPQPPQTYYVECPPVYYTETRYVEYPVSTYMPAPALQPGYTYVECPAVGQGQGQGQGGFSTQYQYQGSYGSCTPQSQSRRSYSSCGPQNQSQASYSYCEPQFQSGPSYTNCGPQRQSQASYGNCTSQLQSRASYSNCSSQRRSGATFSTCAPRCQSQGTYGSYTSQRRSQSTSRCLPPRRLQPSYRSCSPPRHSEPCYSSCLPSRCSSGSYNYCTPPRRSEPIYGSHCPPRGRPSGCSQRCGPKCRVEISSPCCPRQVPPQRCPVQIPPFRGRSQSCPRQPSWGVSCPDLRPRADPHPFPRSCRPQHLDRSPESSRQRCPVPAPRPYPRPQPCPSPEPRPYPRPQPCPSPEPRPRPCPQPCPSPEPRPCPPLRRFSEPCLYPEPCSAPQPVPHPAPRPVPRPRPVHCENPGPRPQPCPLPHPEPMPRPAPCSSPEPCGQPVRCPSPCSGPNPVPYRQELGCHESNPCRLDTEGPRCGSYNFTQRQESNGSCESGDVFSGSHGLSGCGDQGNTCGGMNCGAYGGAKGAYF

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

75.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF568 conjugate, 0.1mg/mL
BNC681461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL
BNC402076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details