Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBP1, Human (His)

ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ZBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zbp1-protein-human-his.html

Purity

92.60

Smiles

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKS

Molecular Formula

81030 (Gene_ID) Q9H171-1 (M1-S149) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus splB Protein (aa 37-240) (strain MSSA476)
VAng-Cr6446-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus splB Protein (aa 37-240) (strain MSSA476)

Sign In for Pricing
View Details
EP300 Rabbit Polyclonal Antibody (Cy7)
orb1055818 100 µL

EP300 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
RRP4 (EXOSC2) (NM_014285) Human Untagged Clone
SC320259 10 µg

RRP4 (EXOSC2) (NM_014285) Human Untagged Clone

Sign In for Pricing
View Details
RB1 Rabbit Polyclonal Antibody (FITC)
orb2938094 100 µg

RB1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
SPON2 (NM_012445) Human Tagged ORF Clone
RC206764 10 µg

SPON2 (NM_012445) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTK9L (TWF2, PTK9L, Twinfilin-2, A6-related Protein, Protein Tyrosine Kinase 9-like, Twinfilin-1-like Protein) (Biotin)
132044-Biotin 100 µL

PTK9L (TWF2, PTK9L, Twinfilin-2, A6-related Protein, Protein Tyrosine Kinase 9-like, Twinfilin-1-like Protein) (Biotin)

Sign In for Pricing
View Details