Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-33A (RAB33A)

Product Specifications

Product Name Alternative

Small GTP-binding protein S10

Abbreviation

Recombinant Human RAB33A protein

Gene Name

RAB33A

UniProt

Q14088

Expression Region

1-237aa

Organism

Homo sapiens (Human)

Target Sequence

MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

A cytochrome P450 monooxygenase involved in the metabolism of steroid hormones and vitamins during embryogenesis. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase) . Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes 3beta-hydroxyandrost-5-en-17-one (dehydroepiandrosterone, DHEA), a precursor in the biosynthesis of androgen and estrogen steroid hormones. Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1), particularly D-ring hydroxylated estrone at the C16-alpha position. Mainly hydroxylates all trans-retinoic acid (atRA) to 4-hydroxyretinoate and may play a role in atRA clearance during fetal development. Also involved in the oxidative metabolism of xenobiotics including anticonvulsants.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tienilic Acid
TRC-T438750-25MG 25 mg

Tienilic Acid

Sign In for Pricing
View Details
Arhgef26 Mouse Gene Knockout Kit (CRISPR)
KN501534 1 Kit

Arhgef26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/1971), CF647 conjugate, 0.1mg/mL
BNC471971-500 1x 500 µL

LMO2 (B-Cell Marker) (LMO2/1971), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Melanoma Marker (PNL2), CF488A conjugate, 0.1mg/mL
BNC880894-500 1x 500 µL

Melanoma Marker (PNL2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cooled Incubator BICL-6102
BICL-6102 1 Unit

Cooled Incubator BICL-6102

Sign In for Pricing
View Details
CANT1 Antibody (Biotin)
KB-7566-01 50 μL

CANT1 Antibody (Biotin)

Sign In for Pricing
View Details