IL-2R beta/CD122, Mouse (HEK293, His)

IL-2R beta (CD122), a type I cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately) [1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R beta with a C-Terminal 6*His tag, which is produced in HEK 293.

Product Specifications

Product Name Alternative

IL-2R beta/CD122 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-2r-beta-cd122-protein-mouse-hek293-his.html

Purity

90.0

Smiles

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Molecular Formula

16185 (Gene_ID) P16297 (A27-E240) (Accession)

Molecular Weight

40-60 kDa

References & Citations

[1]Xiujuan Zhou, et al. Interleukin-2 (IL-2) Interacts With IL-2 Receptor Beta (IL-2Rβ) : Its Potential to Enhance the Proliferation of CD4+ T Lymphocytes in Flounder (Paralichthys olivaceus) . Front Immunol. 2020 Sep 9;11:531789.|[2]R N Bamfordm, et al. The interleukin (IL) 2 receptor beta chain is shared by IL-2 and a cytokine, provisionally designated IL-T, that stimulates T-cell proliferation and the induction of lymphokine-activated killer cells. Proc Natl Acad Sci U S A.1995 May|[3]Xiujuan Zhou, et al. Immunological characteristics of Interleukin-2 receptor subunit beta (IL-2Rβ) in flounder (Paralichtlys olivaceus) : Implication for IL-2R function. Fish Shellfish Immunol. 2019 Oct;93:641-652.|[4]Akira Sakai, et al. The role of tumor-associated macrophages on serum soluble IL-2R levels in B-cell lymphomas. J Clin Exp Hematop. 2014;54 (1) :49-58.|[5]M Allouche, et al. Interleukin 2 receptors. Leuk Res. 1990;14 (8) :699-704.