Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-2R beta/CD122, Mouse (HEK293, His)

IL-2R beta (CD122), a type I cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately) [1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R beta with a C-Terminal 6*His tag, which is produced in HEK 293.

Product Specifications

Product Name Alternative

IL-2R beta/CD122 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-2r-beta-cd122-protein-mouse-hek293-his.html

Purity

90.0

Smiles

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Molecular Formula

16185 (Gene_ID) P16297 (A27-E240) (Accession)

Molecular Weight

40-60 kDa

References & Citations

[1]Xiujuan Zhou, et al. Interleukin-2 (IL-2) Interacts With IL-2 Receptor Beta (IL-2Rβ) : Its Potential to Enhance the Proliferation of CD4+ T Lymphocytes in Flounder (Paralichthys olivaceus) . Front Immunol. 2020 Sep 9;11:531789.|[2]R N Bamfordm, et al. The interleukin (IL) 2 receptor beta chain is shared by IL-2 and a cytokine, provisionally designated IL-T, that stimulates T-cell proliferation and the induction of lymphokine-activated killer cells. Proc Natl Acad Sci U S A.1995 May|[3]Xiujuan Zhou, et al. Immunological characteristics of Interleukin-2 receptor subunit beta (IL-2Rβ) in flounder (Paralichtlys olivaceus) : Implication for IL-2R function. Fish Shellfish Immunol. 2019 Oct;93:641-652.|[4]Akira Sakai, et al. The role of tumor-associated macrophages on serum soluble IL-2R levels in B-cell lymphomas. J Clin Exp Hematop. 2014;54 (1) :49-58.|[5]M Allouche, et al. Interleukin 2 receptors. Leuk Res. 1990;14 (8) :699-704.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad2-S467 Rabbit mAb
AP1347 50 µL

Phospho-Smad2-S467 Rabbit mAb

Sign In for Pricing
View Details
VAMP1 Human shRNA Plasmid Kit (Locus ID 6843)
TR300592 1 Kit

VAMP1 Human shRNA Plasmid Kit (Locus ID 6843)

Sign In for Pricing
View Details
Rabbit Polyclonal Collagen I alpha 1 Antibody [DyLight 650]
NBP1-77457C 0.1 mL

Rabbit Polyclonal Collagen I alpha 1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Trappc6b 3'UTR Luciferase Stable Cell Line
TU222397 1.0 mL

Trappc6b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HDDC3 Polyclonal Antibody, APC Conjugated
bs-8061R-APC 100 µL

HDDC3 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Ticarcillin Disodium Salt-13C3 (Contain 10% Methanol)
467625-01 500 µg

Ticarcillin Disodium Salt-13C3 (Contain 10% Methanol)

Sign In for Pricing
View Details