Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-synuclein (Sncg)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sncg

UniProt

Q9Z0F7

Expression Region

1-123aa

Organism

Mus musculus

Target Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Neuroscience

Assay Type

Developed Protein

Relevance

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Plin4 shRNA (UAS) - Lentiviral mouse Plin4 shRNA (UAS, RFP) (100)
GTR15165396 1 Vial

Lentiviral mouse Plin4 shRNA (UAS) - Lentiviral mouse Plin4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-MOX1  (2E12)
YF-MA14218 100 ug

Anti-MOX1 (2E12)

Sign In for Pricing
View Details
BRUNOL6 sgRNA CRISPR Lentivector (Human) (Target 1)
K0197002 1.0 µg DNA

BRUNOL6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Regulating synaptic membrane exocytosis protein 2 (RIMS2) ELISA Kit
abx542403 96 Tests

Human Regulating synaptic membrane exocytosis protein 2 (RIMS2) ELISA Kit

Sign In for Pricing
View Details
Bag3 (AB1937) Rabbit mAb
M3266-01 20 µL

Bag3 (AB1937) Rabbit mAb

Sign In for Pricing
View Details
Bag3 (AB1937) Rabbit mAb
M3266-02 50 μL

Bag3 (AB1937) Rabbit mAb

Sign In for Pricing
View Details