Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 14 (CCL14)

Product Specifications

CAS Number

9000-83-3

Gene Name

CCL14

UniProt

Q16627

Expression Region

20-93aa

Organism

Homo sapiens

Target Sequence

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Field of Research

Immunology

Assay Type

Developed Protein

Relevance

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca2+ changes and enzyme release, but no chotaXIs, at concentrations of 100-1, 000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1 (9-74) is a chotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca (2+) changes and enzyme release, but no chemotaXIs, at concentrations of 100-1, 000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1 (9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Molecular Weight

24.7 kDa

References & Citations

HCC-1, a novel chemokine from human plasma.Schulz-Knappe P., Maegert H.-J., Dewald B., Meyer M., Cetin Y., Kubbies M., Tomeczkowski J., Kirchhoff K., Raida M., Adermann K., Kist A., Reinecke M., Sillard R., Pardigol A., Uguccioni M., Baggiolini M., Forssmann W.-G.J. Exp. Med. 183:295-299 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit
abx252967-01 96 Tests

Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit

Sign In for Pricing
View Details
Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit
abx252967-02 5x 96 Tests

Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit

Sign In for Pricing
View Details
Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit
abx252967-03 10x 96 Tests

Human Pyruvate Kinase, Liver And RBC (PKLR) ELISA Kit

Sign In for Pricing
View Details
Human ELAV-like protein 4 (ELAVL4) ELISA Kit
RK10912 96 Tests

Human ELAV-like protein 4 (ELAVL4) ELISA Kit

Sign In for Pricing
View Details
ZNF33AP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV790131 1.0 µg DNA

ZNF33AP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Puerto Rico/8/1934) Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8105639-01 0.02 mL

Influenza A H1N1 (A/Puerto Rico/8/1934) Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details