Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CNTF, Mouse (His)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. Animal-Free CNTF Protein, Mouse (His) is produced by E. coli (M1-M198) with C-terminal His-tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CNTF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cntf-protein-mouse-his.html

Purity

98.0

Smiles

MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM

Molecular Formula

12803 (Gene_ID) P51642 (M1-M198) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[2]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[3]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[4]Holm NR, et al. CNTF inhibits high voltage activated Ca2+ currents in fetal mouse cortical neurones. J Neurochem. 2002 Aug;82 (3) :495-503.|[5]Watt MJ, et al. CNTF reverses obesity-induced insulin resistance by activating skeletal muscle AMPK. Nat Med. 2006 May;12 (5) :541-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC685186 3'UTR GFP Stable Cell Line
TU261197 1.0 mL

LOC685186 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IARS Protein Vector (Rat) (pPB-C-His)
PV273862 500 ng

IARS Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
2-Chloro-4- (Tert-Pentyl) Phenol
RG-A261606-01 10 mg

2-Chloro-4- (Tert-Pentyl) Phenol

Sign In for Pricing
View Details
2-Chloro-4- (Tert-Pentyl) Phenol
RG-A261606-02 25 mg

2-Chloro-4- (Tert-Pentyl) Phenol

Sign In for Pricing
View Details
2-Chloro-4- (Tert-Pentyl) Phenol
RG-A261606-03 50 mg

2-Chloro-4- (Tert-Pentyl) Phenol

Sign In for Pricing
View Details
2-Chloro-4- (Tert-Pentyl) Phenol
RG-A261606-04 100 mg

2-Chloro-4- (Tert-Pentyl) Phenol

Sign In for Pricing
View Details