Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Matrix metalloproteinase-14 (Mmp14)

Product Specifications

Product Name Alternative

MMP-14; MMP-X1; MT-MMP; Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1; Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP

Abbreviation

Recombinant Mouse Mmp14 protein

Gene Name

Mmp14

UniProt

P53690

Expression Region

112-582aa

Organism

Mus musculus (Mouse)

Target Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues. Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEOX2 Protein Vector (Human) (pPM-C-His)
PV025560 500 ng

MEOX2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
URM1 AAV Vector (Rat) (CMV)
49250106 1 µg

URM1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
MBS2702884-01 24 Strip Well

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
MBS2702884-02 48 Well

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
MBS2702884-03 96 Well

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
MBS2702884-04 5x 96 Well

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details