Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP1, Human (His)

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF4EBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif4ebp1-protein-human-his.html

Purity

98.0

Smiles

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Molecular Formula

1978 (Gene_ID) Q13541 (M1-I118) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Milk Fat Globulin (MFG-06), CF640R conjugate, 0.1mg/mL
BNC400227-100 1x 100 µL

Milk Fat Globulin (MFG-06), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FRG2 Human Gene Knockout Kit (CRISPR)
KN416000 1 Kit

FRG2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D4 GDI Rabbit Polyclonal Antibody
HA500217 100 µL

D4 GDI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
11-Azaartemisinin
TRC-A794900-1MG 1 mg

11-Azaartemisinin

Sign In for Pricing
View Details
Recombinant CD8A Antibody
RC-3902-01 50 μL

Recombinant CD8A Antibody

Sign In for Pricing
View Details
Recombinant CD8A Antibody
RC-3902-02 100 µL

Recombinant CD8A Antibody

Sign In for Pricing
View Details