Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP1, Human (His)

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF4EBP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif4ebp1-protein-human-his.html

Purity

98.0

Smiles

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Molecular Formula

1978 (Gene_ID) Q13541 (M1-I118) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100042065 shRNA (m) Lentiviral Particles
sc-147857-V 200 µL

LOC100042065 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
MYL12B sgRNA CRISPR Lentivector set (Human)
K1376601 3x 1.0 µg

MYL12B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
LIMK-2 CRISPR Activation Plasmid (m)
sc-421437-ACT 20 µg

LIMK-2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal SATB2 Antibody (rSATB2/8635) [Janelia Fluor 525]
NBP3-24245JF525 0.1 mL

Mouse Monoclonal SATB2 Antibody (rSATB2/8635) [Janelia Fluor 525]

Sign In for Pricing
View Details
Olfr1056 (NM_147018) Mouse Tagged Lenti ORF Clone
MR215528L3 10 µg

Olfr1056 (NM_147018) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Aqueous Humor Frozen 20ml
IGBOAQHZ20ML 20 mL

Innovative Grade US Origin Bovine Aqueous Humor Frozen 20ml

Sign In for Pricing
View Details