Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RD, Mouse (CHO)

Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Mouse (CHO) is produced in CHO cells, and consists of 2713 amino acids (G29-R299) .

Product Specifications

Product Name Alternative

IL-17RD Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rd-protein-mouse-cho.html

Purity

95.00

Smiles

GSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIR

Molecular Formula

171463 (Gene_ID) Q8JZL1-1 (G29-R299) (Accession)

Molecular Weight

31-67 kDa

References & Citations

[1]Shivangi Pande, et al. Interleukin-17 receptor D (Sef) is a multi-functional regulator of cell signaling. Cell Commun Signal. 2021 Jan 12;19 (1) :6.|[2]Mark Mellett, et al. Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions. Nat Commun. 2015 Mar 26;6:6669.|[3]Sihan Liu, et al. A shedding soluble form of interleukin-17 receptor D exacerbates collagen-induced arthritis through facilitating TNF-α-dependent receptor clustering. Cell Mol Immunol. 2021 Aug;18 (8) :1883-1895.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFR-2/CD120b His Tag Protein, Mouse
UA010575-01 25 µg

TNFR-2/CD120b His Tag Protein, Mouse

Sign In for Pricing
View Details
TNFR-2/CD120b His Tag Protein, Mouse
UA010575-02 100 µg

TNFR-2/CD120b His Tag Protein, Mouse

Sign In for Pricing
View Details
TNFR-2/CD120b His Tag Protein, Mouse
UA010575-03 500 µg

TNFR-2/CD120b His Tag Protein, Mouse

Sign In for Pricing
View Details
PHF6 Antibody (HRP)
orb352306-01 50 µg

PHF6 Antibody (HRP)

Sign In for Pricing
View Details
PHF6 Antibody (HRP)
orb352306-02 100 µg

PHF6 Antibody (HRP)

Sign In for Pricing
View Details
Phospho-Histone H1.3 (T17) +H1.4 (T17) Antibody
abx215892-01 50 µg

Phospho-Histone H1.3 (T17) +H1.4 (T17) Antibody

Sign In for Pricing
View Details