Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein-lysine 6-oxidase (Lox)

Product Specifications

Product Name Alternative

Lysyl oxidase (Ras excision protein) (Rrg)

Abbreviation

Recombinant Mouse Lox protein

Gene Name

Lox

UniProt

P28301

Expression Region

163-411aa

Organism

Mus musculus (Mouse)

Target Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Tag

C-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

"Loss of function mutation in LOX causes thoracic aortic aneurysm and dissection in humans." Brigham Genomic Medicine Lee V.S., Halabi C.M., Hoffman E.P., Carmichael N., Leshchiner I., Lian C.G., Bierhals A.J., Vuzman D., Mecham R.P., Frank N.Y., Stitziel N.O. Proc. Natl. Acad. Sci. U.S.A. 113:8759-8764 (2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL
BNC472993-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL
BNC401926-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details