Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TWISTNB Protein Vector (Mouse) (pPM-C-HA)
48858024 500 ng

TWISTNB Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DS-1001b 50mg
A22236-50 50 mg

DS-1001b 50mg

Sign In for Pricing
View Details
Eef1d (NM_029663) Mouse Tagged Lenti ORF Clone
MR209833L4 10 µg

Eef1d (NM_029663) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal DACH1 Antibody
NBP1-85320-25ul 25 µL

Rabbit Polyclonal DACH1 Antibody

Sign In for Pricing
View Details
Erbb2 (NM_001003817) Mouse Tagged ORF Clone
MR227307 10 µg

Erbb2 (NM_001003817) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GP107, NT (Lung seven transmembrane receptor 1, Protein GPR107,LUSTR1, KIAA1624, GPR107) (MaxLight 650)
MBS6303367-01 0.1 mL

GP107, NT (Lung seven transmembrane receptor 1, Protein GPR107,LUSTR1, KIAA1624, GPR107) (MaxLight 650)

Sign In for Pricing
View Details