Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tollip Mouse siRNA Oligo Duplex (Locus ID 54473)
SR407872 1 Kit

Tollip Mouse siRNA Oligo Duplex (Locus ID 54473)

Sign In for Pricing
View Details
FANCB Antibody, Biotin conjugated
A61463-100UG 100 µg

FANCB Antibody, Biotin conjugated

Sign In for Pricing
View Details
FOXD4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0795603 1.0 µg DNA

FOXD4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Papss1 (NM_011863) Mouse Untagged Clone
MC219816 10 µg

Papss1 (NM_011863) Mouse Untagged Clone

Sign In for Pricing
View Details
Box of 200 Cyto-Centrifugal Filter, 26X63 Mm + 1 Hole
CY430F2663_1TQ Box of 200

Box of 200 Cyto-Centrifugal Filter, 26X63 Mm + 1 Hole

Sign In for Pricing
View Details
NODAL (Nodal Homolog, NODAL) (MaxLight 550)
MBS6457709-01 0.1 mL

NODAL (Nodal Homolog, NODAL) (MaxLight 550)

Sign In for Pricing
View Details