Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB)
122950 50 µg

ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB)

Sign In for Pricing
View Details
C14orf178 Protein Vector (Human) (pPB-His-GST)
PV328835 500 ng

C14orf178 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Gata3 (NM_133293) Rat Tagged ORF Clone
RR205255 10 µg

Gata3 (NM_133293) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Sqor shRNA (UAS) - Lentiviral mouse Sqor shRNA (UAS, iRFP) plasmid
GTR15240052 1 Vial

Lentiviral mouse Sqor shRNA (UAS) - Lentiviral mouse Sqor shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Cullin 3 Recombinant Rabbit mAb
E43S47294 100 µL

Cullin 3 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Biotinylated Anti-GFRA3 (nadecnemab biosimilar) mAb
12-9182B-50 50 µg

Biotinylated Anti-GFRA3 (nadecnemab biosimilar) mAb

Sign In for Pricing
View Details