Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit
EIA06518h 1 Kit

Human Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit

Sign In for Pricing
View Details
Human C19orf48 activation kit by CRISPRa
GA113696 1 Kit

Human C19orf48 activation kit by CRISPRa

Sign In for Pricing
View Details
RPL23AP5 CRISPR Knock Out 293T Cell Line (Human)
41175141 1x 10^6 Cells / 1.0 mL

RPL23AP5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Colon Cancer Specific Antigen-3 (CCSA-3) Chicken ELISA Kit
C2209 96 Tests

Colon Cancer Specific Antigen-3 (CCSA-3) Chicken ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Inf2 shRNA (UAS) - Lentiviral mouse Inf2 shRNA (UAS, RFP) (25)
GTR15280823 1 Vial

Lentiviral mouse Inf2 shRNA (UAS) - Lentiviral mouse Inf2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Bifunctional protein FolD (folD)
MBS1079151-01 0.02 mg (E-Coli)

Recombinant Shewanella halifaxensis Bifunctional protein FolD (folD)

Sign In for Pricing
View Details