Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ghrelin Blocking Peptide (Obestatin prepropeptide , GHRL, Ghrl, ghrl) discontinued
G2033-75B1 50 µg

Ghrelin Blocking Peptide (Obestatin prepropeptide , GHRL, Ghrl, ghrl) discontinued

Sign In for Pricing
View Details
L-2-Nitrophenylalanine
TRC-N502235-100MG 100 mg

L-2-Nitrophenylalanine

Sign In for Pricing
View Details
FDX1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV677974 1.0 µg DNA

FDX1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
H3C1 Human Pre-designed siRNA Set A
HY-RS05966 1 Set

H3C1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cyclin D1 (bcl 1) (BSA & Azide Free) (APC)
MBS6471219-01 0.1 mL

Cyclin D1 (bcl 1) (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
Cyclin D1 (bcl 1) (BSA & Azide Free) (APC)
MBS6471219-02 5x 0.1 mL

Cyclin D1 (bcl 1) (BSA & Azide Free) (APC)

Sign In for Pricing
View Details