Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ncoa2 Mouse shRNA Lentiviral Particle (Locus ID 17978)
TL501444V 500 µL Each

Ncoa2 Mouse shRNA Lentiviral Particle (Locus ID 17978)

Sign In for Pricing
View Details
Human ANKRD20A3 knockdown cell line
ABC-KD0657 1 Vial

Human ANKRD20A3 knockdown cell line

Sign In for Pricing
View Details
TERF1P5 Protein Lysate (Human) with C-Ha Tag
46502031 100 µg

TERF1P5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Acetyl 2,3,6-Tri-O-acetyl-4-O- (2,3,4,6-tetra-o-acetyl-a-D-mannopyranosyl) -D-glucopyranoside
MBS6053678-01 2.5 mg

Acetyl 2,3,6-Tri-O-acetyl-4-O- (2,3,4,6-tetra-o-acetyl-a-D-mannopyranosyl) -D-glucopyranoside

Sign In for Pricing
View Details
Acetyl 2,3,6-Tri-O-acetyl-4-O- (2,3,4,6-tetra-o-acetyl-a-D-mannopyranosyl) -D-glucopyranoside
MBS6053678-02 5x 2.5 mg

Acetyl 2,3,6-Tri-O-acetyl-4-O- (2,3,4,6-tetra-o-acetyl-a-D-mannopyranosyl) -D-glucopyranoside

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein 106C (TMEM106C), partial
MBS7057355 Inquire

Recombinant Human Transmembrane protein 106C (TMEM106C), partial

Sign In for Pricing
View Details