Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dehydro Aripiprazole-d8
445981 1 mg

Dehydro Aripiprazole-d8

Sign In for Pricing
View Details
Rabbit Polyclonal DDX21 Antibody
NBP2-38311-25ul 25 µL

Rabbit Polyclonal DDX21 Antibody

Sign In for Pricing
View Details
Lentiviral mouse 6030458C11Rik shRNA (UAS) - Lentiviral mouse 6030458C11Rik shRNA (UAS, RFP) (100)
GTR15115032 1 Vial

Lentiviral mouse 6030458C11Rik shRNA (UAS) - Lentiviral mouse 6030458C11Rik shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-TIM
Y123015 100 µL

Anti-TIM

Sign In for Pricing
View Details
Monkey COL1alpha1 (Collagen Type I Alpha 1) ELISA Kit
MBS2502810-01 24 Tests

Monkey COL1alpha1 (Collagen Type I Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Monkey COL1alpha1 (Collagen Type I Alpha 1) ELISA Kit
MBS2502810-02 48 Tests

Monkey COL1alpha1 (Collagen Type I Alpha 1) ELISA Kit

Sign In for Pricing
View Details