Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100042428 Protein Vector (Mouse) (pPM-C-His)
PV197121 500 ng

LOC100042428 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal UCH-L3 Antibody (007) [Alexa Fluor 594]
NBP2-90878AF594 0.1 mL

Rabbit Monoclonal UCH-L3 Antibody (007) [Alexa Fluor 594]

Sign In for Pricing
View Details
Retinoblastoma, Phosphorylated (S811) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 650)
MBS6435546-01 0.1 mL

Retinoblastoma, Phosphorylated (S811) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 650)

Sign In for Pricing
View Details
Retinoblastoma, Phosphorylated (S811) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 650)
MBS6435546-02 5x 0.1 mL

Retinoblastoma, Phosphorylated (S811) (RB, RB1, RB, pRb, OSRC, pp110, p105-Rb) (MaxLight 650)

Sign In for Pricing
View Details
Human ACPP Protein
B2010975 100 µg

Human ACPP Protein

Sign In for Pricing
View Details
Hemoglobin (FITC)
547434 200 µL

Hemoglobin (FITC)

Sign In for Pricing
View Details