Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM129B (Niban-like Protein 1, Family with Sequence Similarity 129, Member B)
480625 100 µL

FAM129B (Niban-like Protein 1, Family with Sequence Similarity 129, Member B)

Sign In for Pricing
View Details
CD40/TNFRSF5 Recombinant Protein Antigen
NBP2-34488PEP 100 µL

CD40/TNFRSF5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Olfr1443 Mouse shRNA Plasmid (Locus ID 258693)
TR507848 1 Kit

Olfr1443 Mouse shRNA Plasmid (Locus ID 258693)

Sign In for Pricing
View Details
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (PE) discontinued
C2381-06 100 Tests

Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (PE) discontinued

Sign In for Pricing
View Details
Cytochrome P450 26B (CYP26B1) (NM_019885) Human Tagged Lenti ORF Clone
RC221075L3 10 µg

Cytochrome P450 26B (CYP26B1) (NM_019885) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Nup42 Pre-designed siRNA Set B
SI109716B 1 Each

Mouse Nup42 Pre-designed siRNA Set B

Sign In for Pricing
View Details