Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf46, CT (CACUL1, C10orf46, CAC1, CDK2-associated and cullin domain-containing protein 1, Cdk-associated cullin1) (APC) discontinued
032642-APC 200 µL

C10orf46, CT (CACUL1, C10orf46, CAC1, CDK2-associated and cullin domain-containing protein 1, Cdk-associated cullin1) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral human TMEM130 sgRNA gene knockout kit - Lentiviral human TMEM130 sgRNA gene knockout kit (25)
GTR15389466 1 Vial

Lentiviral human TMEM130 sgRNA gene knockout kit - Lentiviral human TMEM130 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
C19orf48 (Uncharacterized Protein C19orf48, Multidrug Resistance-Related Protein, C19orf48) discontinued
221213-01 50 µL

C19orf48 (Uncharacterized Protein C19orf48, Multidrug Resistance-Related Protein, C19orf48) discontinued

Sign In for Pricing
View Details
C19orf48 (Uncharacterized Protein C19orf48, Multidrug Resistance-Related Protein, C19orf48) discontinued
221213-02 100 µL

C19orf48 (Uncharacterized Protein C19orf48, Multidrug Resistance-Related Protein, C19orf48) discontinued

Sign In for Pricing
View Details
SPRR2C AAV siRNA Pooled Vector
45388161 1.0 µg

SPRR2C AAV siRNA Pooled Vector

Sign In for Pricing
View Details
XL147 analogue
C07535-01 10 mg

XL147 analogue

Sign In for Pricing
View Details