Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-mouse-hek293-hfc.html

Purity

93.20

Smiles

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Molecular Formula

234199 (Gene_ID) NP_663569.2 (L23-I314) (Accession)

Molecular Weight

Approximately 60.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL
BNC882290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL
BNC401989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF405S conjugate, 0.1mg/mL
BNC042174-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF640R conjugate, 0.1mg/mL
BNC402168-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details