Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal-induced proliferation-associated 1-like protein 2 (SIPA1L2), partial

Product Specifications

Product Name Alternative

SIPA1-like protein 2

Abbreviation

Recombinant Human SIPA1L2 protein, partial

Gene Name

SIPA1L2

UniProt

Q9P2F8

Expression Region

595-812aa

Organism

Homo sapiens (Human)

Target Sequence

LLKLDEQGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNKTDSTGTHSLYTTYKDYELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFTPKSIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL
BNC882540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF568 conjugate, 0.1mg/mL
BNC681188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF647 conjugate, 0.1mg/mL
BNC470743-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL
BNC880675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL
BNC472174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL
BNC041718-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details