FABP3, Mouse
FABP3 is a member of the fatty acid-binding protein (FABP) family and is thought to facilitate the intracellular transport of long-chain fatty acids and their acyl-CoA esters. As part of this family of proteins, FABP3 may play a crucial role in promoting cellular uptake and transport of fatty acids, supporting various metabolic processes within cells. FABP3 Protein, Mouse is the recombinant mouse-derived FABP3 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FABP3 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fabp3-protein-mouse.html
Purity
98.0
Smiles
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA
Molecular Formula
14077 (Gene_ID) P11404 (M1-A133) (Accession)
Molecular Weight
Approximately 14.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), Biotin conjugate, 0.1mg/mL
![ZNF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]](https://cdn.genprice.uk/products/937/6868c409994c49e6dc404d58/imageurl/ta811017am.webp)
ZNF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]
