Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUVBL2, Human (His-SUMO)

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RUVBL2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ruvbl2-protein-human-his-sumo.html

Purity

95.0

Smiles

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Molecular Formula

10856 (Gene_ID) Q9Y230-1 (A2-S463) (Accession)

Molecular Weight

Approximately 67.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M1 Human Gene Knockout Kit (CRISPR)
KN419784 1 Kit

OR5M1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ccdc182 Mouse Gene Knockout Kit (CRISPR)
KN500170 1 Kit

Ccdc182 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF647 conjugate, 0.1mg/mL
BNC470818-500 1x 500 µL

CD45RA (PTPRC/818), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Col11a1 Mouse Gene Knockout Kit (CRISPR)
KN503614 1 Kit

Col11a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF740 conjugate, 0.1mg/mL
BNC741982-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.8 (NKX28/2548), CF568 conjugate, 0.1mg/mL
BNC682548-100 1x 100 µL

NKX2.8 (NKX28/2548), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details