Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUVBL2, Human (His-SUMO)

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

RUVBL2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ruvbl2-protein-human-his-sumo.html

Purity

95.0

Smiles

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Molecular Formula

10856 (Gene_ID) Q9Y230-1 (A2-S463) (Accession)

Molecular Weight

Approximately 67.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA10 AAV Vector (Human) (CMV)
21533101 1 µg

GJA10 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TDGF1 discontinued
336764 100 µL

TDGF1 discontinued

Sign In for Pricing
View Details
Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-01 96 Well

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-02 5x 96 Tests

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-03 10x 96 Tests

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
BlueRAY Prestained Protein Ladder
MBS402056 Inquire

BlueRAY Prestained Protein Ladder

Sign In for Pricing
View Details