Question 1

What is the catalog number for S3QEL-2?

Accepted Answer

The catalog number for S3QEL-2 is orb1701599.

Question 2

What sizes are available for S3QEL-2?

Accepted Answer

S3QEL-2 is available in the following size(s): 5 mg, 1 ml x 10 mM (in DMSO), 10 mg, 25 mg, 50 mg, 100 mg.

Question 3

How many pack sizes does S3QEL-2 come in?

Accepted Answer

S3QEL-2 is available in 6 different pack sizes.

Question 4

Is S3QEL-2 in stock?

Accepted Answer

S3QEL-2 is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is S3QEL-2 used for?

Accepted Answer

S3QEL-2 is a neuroprotective small molecule that selectively inhibits superoxide production at mitochondrial complex III. It demonstrates dose-dependent anti-proliferative effects on PC-3 prostate cancer cells under pyruvate-starved conditions, making it a useful research tool for studying redox bio

Question 6

Is this product suitable for live cell imaging?

Accepted Answer

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Question 7

Is this product covered by a money-back guarantee?

Accepted Answer

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Question 8

Can this product be used for diagnostic or therapeutic purposes?

Accepted Answer

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

S3QEL-2

Product Specifications

CAS Number

Product Name Alternative

Field of Research

Purity

Solubility

Smiles

Molecular Formula

Molecular Weight

Storage Conditions

Notes

Available Sizes

Frequently Asked Questions

Explore Other Products

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Biotin-labeled horseradish peroxidase

CCNG1, CT (CCNG1, CCNG, CYCG1, Cyclin-G1) (PE) discontinued

ADGRE1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Human GatC-like protein, GATC ELISA Kit