Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic aspartyl protease Rabbit pAb
E47R0613 100 µL

Eukaryotic aspartyl protease Rabbit pAb

Sign In for Pricing
View Details
Scd 3'UTR Luciferase Stable Cell Line
TU219959 1.0 mL

Scd 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RORα3 siRNA (h)
sc-38868 10 µM

RORα3 siRNA (h)

Sign In for Pricing
View Details
FKBP51 (FKBP5) (NM_001145777) Human Tagged ORF Clone Lentiviral Particle
RC227059L3V 200 µL

FKBP51 (FKBP5) (NM_001145777) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse anti-human AMH mAb (H18)
A09J07-H18 1 Each

Mouse anti-human AMH mAb (H18)

Sign In for Pricing
View Details
Recombinant Thermobifida fusca Proteasome subunit alpha (prcA)
MBS1291076-01 0.02 mg (E-Coli)

Recombinant Thermobifida fusca Proteasome subunit alpha (prcA)

Sign In for Pricing
View Details