Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KEL, ID (KEL, Kell blood group glycoprotein, CD238) (FITC) discontinued
037379-FITC 200 µL

KEL, ID (KEL, Kell blood group glycoprotein, CD238) (FITC) discontinued

Sign In for Pricing
View Details
CRIP2 (NM_001270841) Human Tagged ORF Clone
RC231594 10 µg

CRIP2 (NM_001270841) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human LRRC70 qPCR Primer Pair
QH82857S 200 Tests

Human LRRC70 qPCR Primer Pair

Sign In for Pricing
View Details
LOC100361915 3'UTR Luciferase Stable Cell Line
TU208148 1.0 mL

LOC100361915 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
pCMV-SPORT6-Pwp1 Plasmid
PVT46266 2 µg

pCMV-SPORT6-Pwp1 Plasmid

Sign In for Pricing
View Details
Rabbit anti-TIGD1 Antibody
MBS4505013-01 0.05 mL

Rabbit anti-TIGD1 Antibody

Sign In for Pricing
View Details