Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERBB2 (T798I_Q799E) BAF3 Cell Line
ABC-X0045C 1 Vial

Human ERBB2 (T798I_Q799E) BAF3 Cell Line

Sign In for Pricing
View Details
PLV3-CMV-TP53BP2-3xHA-CopGFP-Puro Plasmid
PVT70789 2 µg

PLV3-CMV-TP53BP2-3xHA-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Fmn1 (NM_001287818) Mouse Untagged Clone
MC225642 10 µg

Fmn1 (NM_001287818) Mouse Untagged Clone

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
MBS2142709-01 0.1 mL

FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
MBS2142709-02 0.2 mL

FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
MBS2142709-03 0.5 mL

FITC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)

Sign In for Pricing
View Details