Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FH535 50mg
A13795-50 50 mg

FH535 50mg

Sign In for Pricing
View Details
Arhgef9 (Center) Rabbit Polyclonal Antibody
AP12327PU-N 400 µL

Arhgef9 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Brs3 3'UTR GFP Stable Cell Line
TU251429 1.0 mL

Brs3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)
MBS2078293-01 0.1 mL

HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)
MBS2078293-02 0.2 mL

HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)
MBS2078293-03 0.5 mL

HRP-Linked Polyclonal Antibody to Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1)

Sign In for Pricing
View Details