Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC1 (HD1, HD-1, HDAC-1, Histone Deacetylase 1, RPD3, RPD3L1, Reduced Potassium Dependency 3, Like-1) discontinued
H1827-51J 100 µg

HDAC1 (HD1, HD-1, HDAC-1, Histone Deacetylase 1, RPD3, RPD3L1, Reduced Potassium Dependency 3, Like-1) discontinued

Sign In for Pricing
View Details
4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide
282962-01 5 mg

4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide

Sign In for Pricing
View Details
4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide
282962-02 10 mg

4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide

Sign In for Pricing
View Details
4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide
282962-03 25 mg

4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide

Sign In for Pricing
View Details
4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide
282962-04 50 mg

4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide

Sign In for Pricing
View Details
4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide
282962-05 100 mg

4-[[ (1R) -3- (4-Morpholinyl) -3-oxo-1-[ (phenylthio) methyl]propyl]amino]-3-trifluoromethylsulfonyl-benzenesulfonamide

Sign In for Pricing
View Details