Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfo Rhodamine Amidoethyl Mercaptan
TRC-S699125-5MG 5 mg

Sulfo Rhodamine Amidoethyl Mercaptan

Sign In for Pricing
View Details
Zfp954 Protein Vector (Mouse) (pPB-N-His)
PV250587 500 ng

Zfp954 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SERPINB10 (Serpin Peptidase Inhibitor, Clade B (ovalbumin), Member 10, PI10, bomapin)
251523 50 µL

SERPINB10 (Serpin Peptidase Inhibitor, Clade B (ovalbumin), Member 10, PI10, bomapin)

Sign In for Pricing
View Details
Azaperol
TRC-A802190-25MG 25 mg

Azaperol

Sign In for Pricing
View Details
RPS6KA3 Antibody, FITC conjugated
A33865-50UG 50 µg

RPS6KA3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Putative membrane protein insertion efficiency factor (lpl2931)
MBS1305072-01 0.02 mg (E-Coli)

Recombinant Legionella pneumophila Putative membrane protein insertion efficiency factor (lpl2931)

Sign In for Pricing
View Details