Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLRX2 Recombinant Protein (Mouse)
RP136754 100 µg

GLRX2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
VPS45 antibody
FNab09443 100 µg

VPS45 antibody

Sign In for Pricing
View Details
DiagPoly™ Plain Polystyrene Particles, Crosslinked, 400.0-600.0µm
DNM-P029CR 10 mL

DiagPoly™ Plain Polystyrene Particles, Crosslinked, 400.0-600.0µm

Sign In for Pricing
View Details
CXCL10 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV676811 1.0 µg DNA

CXCL10 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Goat anti-Apolipoprotein L4 Antibody
MBS421696-01 0.1 mg

Goat anti-Apolipoprotein L4 Antibody

Sign In for Pricing
View Details
Goat anti-Apolipoprotein L4 Antibody
MBS421696-02 5x 0.1 mg

Goat anti-Apolipoprotein L4 Antibody

Sign In for Pricing
View Details