Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Desmin/DES, Human (His)

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Desmin/DES Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/desmin-des-protein-human-his.html

Purity

97.35

Smiles

VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Molecular Formula

1674 (Gene_ID) P17661 (V261-L470) (Accession)

Molecular Weight

Approximately 29.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Fish Progesterone (PROG) ELISA
KLF0300 1x 96 Well

GENLISA Fish Progesterone (PROG) ELISA

Sign In for Pricing
View Details
Rabbit Peptidoglycan, PG GENLISA ELISA
KLX0293 96 Well

Rabbit Peptidoglycan, PG GENLISA ELISA

Sign In for Pricing
View Details
Rat Anti-Mouse TNF-a-LE/AF
MBS670600-01 0.5 mg

Rat Anti-Mouse TNF-a-LE/AF

Sign In for Pricing
View Details
Rat Anti-Mouse TNF-a-LE/AF
MBS670600-02 5x 0.5 mg

Rat Anti-Mouse TNF-a-LE/AF

Sign In for Pricing
View Details
Lentiviral mouse Tppp3 shRNA (UAS) - Lentiviral mouseTppp3 shRNA (UAS, GFP) (25)
GTR15277340 1 Vial

Lentiviral mouse Tppp3 shRNA (UAS) - Lentiviral mouseTppp3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (APC)
248522-APC 100 µL

MAPK9 (Mitogen-Activated Protein Kinase 9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, p54a, p54aSAPK) (APC)

Sign In for Pricing
View Details