Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial (Active)

Product Specifications

Product Name Alternative

Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

Abbreviation

Recombinant Human EGF protein, partial (Active)

Gene Name

EGF

UniProt

P01133

Expression Region

971-1023aa

Organism

Homo sapiens (Human)

Target Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Epidermal growth factor (EGF) is a small 53 amino acid residue long protein that contains three disulfide bridges. It is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 60-450 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro

Molecular Weight

6.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-01 0.02 mg (E-Coli)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details
Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-02 0.02 mg (Yeast)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details
Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-03 0.1 mg (E-Coli)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details
Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-04 0.1 mg (Yeast)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details
Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-05 0.02 mg (Baculovirus)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details
Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)
MBS1165150-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella newport Non-specific ribonucleoside hydrolase rihC (rihC)

Sign In for Pricing
View Details