Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcium-sensing R/CaSR, Human (HEK293, His)

Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing R/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing R/CaSR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Calcium-sensing R/CaSR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcium-sensing-r-casr-protein-human-hek293-his.html

Purity

95.00

Smiles

YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK

Molecular Formula

846 (Gene_ID) P41180-1 (Y20-K601) (Accession)

Molecular Weight

Approximately 95-130 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0CP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV757871 1.0 µg DNA

ATP6V0CP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FCAR/CD89 Recombinant Antibody, PE Conjugated
bsm-61854R-PE-01 20 µL

FCAR/CD89 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
FCAR/CD89 Recombinant Antibody, PE Conjugated
bsm-61854R-PE-02 100 µL

FCAR/CD89 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Nell2 3'UTR GFP Stable Cell Line
TU263892 1.0 mL

Nell2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mpi Mouse Gene Knockout Kit (CRISPR)
KN510249 1 Kit

Mpi Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5,5,5-Trifluoropentanal
AKA25347-01 50 mg

5,5,5-Trifluoropentanal

Sign In for Pricing
View Details