Lymphocyte antigen 6H/LY6H, Human (HEK293, His)
LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
CAS Number
9007-83-4
Product Name Alternative
Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lymphocyte-antigen-6h-protein-human-hek-293-his.html
Smiles
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
Molecular Formula
4062 (Gene_ID) O94772 (L26-G115) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CF®594 Rabbit Anti-Human IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
Human ECM1 (Extracellular Matrix Protein 1) ELISA Kit
