Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH, Human (GST)

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (GST) is the recombinant human-derived PTH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

PTH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pth-protein-human-gst.html

Purity

97.0

Smiles

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Molecular Formula

5741 (Gene_ID) P01270 (S32-F65) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CREM Antibody
NBP1-81760-25ul 25 µL

Rabbit Polyclonal CREM Antibody

Sign In for Pricing
View Details
TRIM10 Rabbit Polyclonal Antibody (Fluoro488)
orb3094482 100 µg

TRIM10 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
PHF21A (NM_001101802) Human Tagged Lenti ORF Clone
RC213929L1 10 µg

PHF21A (NM_001101802) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Lct Pre-designed siRNA Set B
SI207534B 1 Each

Rat Lct Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human GBF1 qPCR Primer Pair
QH26993S 200 Tests

Human GBF1 qPCR Primer Pair

Sign In for Pricing
View Details
ZNF816A Double Nickase Plasmid (h)
sc-418466-NIC 20 µg

ZNF816A Double Nickase Plasmid (h)

Sign In for Pricing
View Details