Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A13, Mouse (His)

S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit. It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles. S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A. S100A13 Protein, Mouse (His) is the recombinant mouse-derived S100A13 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A13 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a13-protein-mouse-n-his.html

Purity

98.0

Smiles

MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK

Molecular Formula

20196 (Gene_ID) P97352 (M1-K98) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human SLC4A1AP shRNA (UAS) - Lentiviral human SLC4A1AP shRNA (UAS, iRFP) (100)
GTR15137451 1 Vial

Lentiviral human SLC4A1AP shRNA (UAS) - Lentiviral human SLC4A1AP shRNA (UAS, iRFP) (100)

Ask
View Details
Hepatitis B virus HBSAG Protein, hFc Tag
MBS189572-01 0.01 mg

Hepatitis B virus HBSAG Protein, hFc Tag

Ask
View Details
Hepatitis B virus HBSAG Protein, hFc Tag
MBS189572-02 0.05 mg

Hepatitis B virus HBSAG Protein, hFc Tag

Ask
View Details
Hepatitis B virus HBSAG Protein, hFc Tag
MBS189572-03 0.1 mg

Hepatitis B virus HBSAG Protein, hFc Tag

Ask
View Details
Hepatitis B virus HBSAG Protein, hFc Tag
MBS189572-04 5x 0.1 mg

Hepatitis B virus HBSAG Protein, hFc Tag

Ask
View Details
Lentiviral human EPHA10 sgRNA gene knockout kit - Lentiviral human EPHA10 sgRNA gene knockout kit (plasmid)
GTR15389744 1 Vial

Lentiviral human EPHA10 sgRNA gene knockout kit - Lentiviral human EPHA10 sgRNA gene knockout kit (plasmid)

Ask
View Details