Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A13, Mouse (His)

S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit. It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles. S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A. S100A13 Protein, Mouse (His) is the recombinant mouse-derived S100A13 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A13 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a13-protein-mouse-n-his.html

Purity

98.0

Smiles

MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK

Molecular Formula

20196 (Gene_ID) P97352 (M1-K98) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Adam1a Rat siRNA Oligo Duplex (Locus ID 56777)
SR503161 1 Kit

Adam1a Rat siRNA Oligo Duplex (Locus ID 56777)

Ask
View Details
Human IGIP knockdown cell line
ABC-KD7248 1 Vial

Human IGIP knockdown cell line

Ask
View Details
CAT3 Antibody
PHY1535A 150 μg

CAT3 Antibody

Ask
View Details
SLITRK2, CT (SLITRK2, CXorf2, KIAA1854, SLITL1, SLIT and NTRK-like protein 2) (MaxLight 550) discontinued
042010-ML550 100 µL

SLITRK2, CT (SLITRK2, CXorf2, KIAA1854, SLITL1, SLIT and NTRK-like protein 2) (MaxLight 550) discontinued

Ask
View Details