Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-33 (Il33), partial (Active)

Product Specifications

Product Name Alternative

Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11

Abbreviation

Recombinant Mouse Il33 protein, partial (Active)

Gene Name

Il33

UniProt

Q8BVZ5

Expression Region

109-266aa

Organism

Mus musculus (Mouse)

Target Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up‑regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL‑1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin Rabbit Polyclonal Antibody
orb381955-01 30 µL

Prohibitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prohibitin Rabbit Polyclonal Antibody
orb381955-02 50 μL

Prohibitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prohibitin Rabbit Polyclonal Antibody
orb381955-03 100 µL

Prohibitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prohibitin Rabbit Polyclonal Antibody
orb381955-04 200 µL

Prohibitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRYAA2 Mouse Monoclonal Antibody [Clone ID: c9F2]
SM6001 100 µL

CRYAA2 Mouse Monoclonal Antibody [Clone ID: c9F2]

Sign In for Pricing
View Details
PPP2R2B (NM_001127381) Human 3' UTR Clone
SC206045 10 µg

PPP2R2B (NM_001127381) Human 3' UTR Clone

Sign In for Pricing
View Details