Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Human (HEK293)

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 70 amino acids (E32-S101) .

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf-4-cxcl4-protein-human-hek293.html

Purity

95.0

Smiles

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Formula

5196 (Gene_ID) P02776 (E32-S101) (Accession)

Molecular Weight

Approximately 7.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109 (10) :4127-34.|[2]Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109 (10) :4127-34.|[3]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[4]Gabriele Domschke, et al. CXCL4-induced macrophages in human atherosclerosis. Cytokine. 2019 Oct;122:154141.|[5]Alsya J Affandi, et al. CXCL4 is a novel inducer of human Th17 cells and correlates with IL-17 and IL-22 in psoriatic arthritis. Eur J Immunol. 2018 Mar;48 (3) :522-531.|[6]Jo Vandercappellen, et al. The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer. Cytokine Growth Factor Rev. 2011 Feb;22 (1) :1-18.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caldesmon Antibody : HRP (OAAF07866-HRP)
OAAF07866-100UG-HRP 100 µg

Caldesmon Antibody : HRP (OAAF07866-HRP)

Sign In for Pricing
View Details
C19orf18 CRISPR Knock Out 293T Cell Line (Human)
14050141 1x 10^6 Cells / 1.0 mL

C19orf18 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Olr651 sgRNA CRISPR Lentivector set (Rat)
K7442201 3x 1.0 µg

Olr651 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody
orb2957333-01 50 µg

RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody

Sign In for Pricing
View Details
RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody
orb2957333-02 100 µg

RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody

Sign In for Pricing
View Details
RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody
orb2957333-03 1 mg

RSV F/Fusion glycoprotein F0 Human Monoclonal Antibody

Sign In for Pricing
View Details