Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-15, Human

IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IL-15 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-15-protein-human.html

Purity

98.0

Smiles

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Formula

3600 (Gene_ID) P40933-1 (N49-S162) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Conlon KC, et al. Redistribution, hyperproliferation, activation of natural killer cells and CD8 T cells, and cytokine production during first-in-human clinical trial of recombinant human interleukin-15 in patients with cancer. J Clin Oncol. 2015 Jan 1;33 (1) :74-82.|[2]Sun W, et al. High level expression and purification of active recombinant human interleukin-15 in Pichiapastoris. J Immunol Methods. 2016 Jan;428:50-7.|[3]O'Leary MF, et al., IL-15 promotes human myogenesis and mitigates the detrimental effects of TNFα on myotube development. Sci Rep. 2017 Oct 11;7 (1) :12997.|[4]Perera L P, et al., IL-15 induces the expression of chemokines and their receptors in T lymphocytes[J]. The Journal of Immunology, 1999, 162 (5) : 2606-2612.|[5]Waldmann TA, et al., Safety (toxicity), pharmacokinetics, immunogenicity, and impact on elements of the normal immune system of recombinant human IL-15 in rhesus macaques. Blood. 2011 May 5;117 (18) :4787-95.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DUSP1 Antibody
RC-16795-01 50 μL

Recombinant DUSP1 Antibody

Sign In for Pricing
View Details
Recombinant DUSP1 Antibody
RC-16795-02 100 µL

Recombinant DUSP1 Antibody

Sign In for Pricing
View Details
Recombinant DUSP1 Antibody
RC-16795-03 1 mL

Recombinant DUSP1 Antibody

Sign In for Pricing
View Details
IL2 Rabbit Polyclonal Antibody
AP20657PU-N 100 µg

IL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERp19 (TXNDC12) Rabbit Polyclonal Antibody
TA366132 100 µL

ERp19 (TXNDC12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDA5 Recombinant Rabbit monoclonal Antibody
HA750890 100 µL

MDA5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details