Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-15, Human

IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IL-15 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-15-protein-human.html

Purity

98.0

Smiles

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Formula

3600 (Gene_ID) P40933-1 (N49-S162) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Conlon KC, et al. Redistribution, hyperproliferation, activation of natural killer cells and CD8 T cells, and cytokine production during first-in-human clinical trial of recombinant human interleukin-15 in patients with cancer. J Clin Oncol. 2015 Jan 1;33 (1) :74-82.|[2]Sun W, et al. High level expression and purification of active recombinant human interleukin-15 in Pichiapastoris. J Immunol Methods. 2016 Jan;428:50-7.|[3]O'Leary MF, et al., IL-15 promotes human myogenesis and mitigates the detrimental effects of TNFα on myotube development. Sci Rep. 2017 Oct 11;7 (1) :12997.|[4]Perera L P, et al., IL-15 induces the expression of chemokines and their receptors in T lymphocytes[J]. The Journal of Immunology, 1999, 162 (5) : 2606-2612.|[5]Waldmann TA, et al., Safety (toxicity), pharmacokinetics, immunogenicity, and impact on elements of the normal immune system of recombinant human IL-15 in rhesus macaques. Blood. 2011 May 5;117 (18) :4787-95.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACAP (ADCYAP1) (NM_001117) Human Recombinant Protein
TP310851L 1 mg

PACAP (ADCYAP1) (NM_001117) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702273 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Syndecan 1 Recombinant Rabbit monoclonal Antibody [JM11-21]
ET1703-42-50UL 50 µL

Syndecan 1 Recombinant Rabbit monoclonal Antibody [JM11-21]

Sign In for Pricing
View Details
Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit
RDR-CLCF1-Hu-01 96 Tests

Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit

Sign In for Pricing
View Details
Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit
RDR-CLCF1-Hu-02 48 Tests

Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit

Sign In for Pricing
View Details
3-Hydroxyhomophthalic Acid
TRC-H942843-1G 1 g

3-Hydroxyhomophthalic Acid

Sign In for Pricing
View Details