Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial

Product Specifications

Product Name Alternative

(CD antigen CD3e)

Abbreviation

Recombinant Pig CD3E protein, partial

Gene Name

CD3E

UniProt

Q7YRN2

Expression Region

22-116aa

Organism

Sus scrofa (Pig)

Target Sequence

QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.2 kDa

References & Citations

"Cloning and sequencing of porcine CD3 epsilon." Wang J., Yang H., Guo X. Submitted (JUN-2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen IX (COL9A1) alpha 1 chain Rabbit Polyclonal Antibody
AP12402PU-N 400 µL

Collagen IX (COL9A1) alpha 1 chain Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAP3K10 Human Gene Knockout Kit (CRISPR)
KN418669 1 Kit

MAP3K10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TCF7L2 (NM_001198530) Human Over-expression Lysate
LY434214 100 µg

TCF7L2 (NM_001198530) Human Over-expression Lysate

Sign In for Pricing
View Details
Btbd6 Mouse Gene Knockout Kit (CRISPR)
KN502299 1 Kit

Btbd6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diquat Dipyridone
TRC-D492905-10MG 10 mg

Diquat Dipyridone

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF405S conjugate, 0.1mg/mL
BNC040683-100 1x 100 µL

Cytokeratin 7 (OV-TL12/30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details