Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.1 (HIST1H3A)

Product Specifications

Product Name Alternative

Histone H3/a (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) (H3FAAND)

Abbreviation

Recombinant Human HIST1H3A protein

Gene Name

HIST1H3A

UniProt

P68431

Expression Region

2-136aa

Organism

Homo sapiens (human)

Target Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.0 kDa

References & Citations

"Characterization of the H1.5 gene completes the set of human H1 subtype genes." Albig W., Meergans T., Doenecke D. Gene 184:141-148 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF594 conjugate, 0.1mg/mL
BNC940024-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Fluoro Phencyclidine Hydrochloride
TRC-F561590-50MG 50 mg

3-Fluoro Phencyclidine Hydrochloride

Sign In for Pricing
View Details
c-Myb (MYB) (NM_001161657) Human Over-expression Lysate
LC431477 20 µg

c-Myb (MYB) (NM_001161657) Human Over-expression Lysate

Sign In for Pricing
View Details
HDHD2 Rabbit Polyclonal Antibody
TA369687 100 µL

HDHD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Glutaminase Antibody
RC-4963-01 50 μL

Recombinant Glutaminase Antibody

Sign In for Pricing
View Details
Recombinant Glutaminase Antibody
RC-4963-02 100 µL

Recombinant Glutaminase Antibody

Sign In for Pricing
View Details