Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, His, solution)

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, His, solution) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 115 amino acids (A20-P134) .

Product Specifications

Product Name Alternative

ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, His, solution), Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2a-activin-riia-protein-human-hek293-his.html

Purity

98.0

Smiles

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPHHHHHH

Molecular Formula

92/102121129 (Gene_ID) P27037-1/G7PKJ4 (A20-P134) (Accession)

Molecular Weight

Approximately 29-37 kDa

References & Citations

[1]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[2]V K Chin, et al. Inhibition of Activin A suppressed tumor necrosis factor-α secretion and improved histopathological conditions in malarial mice. Trop Biomed. 2021 Mar 1;38 (1) :187-204.|[3]Szabina Szófia Szilágyi, et al. Competition between type I activin and BMP receptors for binding to ACVR2A regulates signaling to distinct Smad pathways. BMC Biol. 2022 Feb 18;20 (1) :50.|[4]Heather L Hayes, et al. A Pdx-1-Regulated Soluble Factor Activates Rat and Human Islet Cell Proliferation. Mol Cell Biol. 2016 Nov 14;36 (23) :2918-2930.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL
BNC940032-100 1x 100 µL

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details