Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2A/Activin RIIA, Human/Cynomolgus (HEK293, His, solution)

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, His, solution) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 115 amino acids (A20-P134) .

Product Specifications

Product Name Alternative

ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, His, solution), Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2a-activin-riia-protein-human-hek293-his.html

Purity

98.0

Smiles

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPHHHHHH

Molecular Formula

92/102121129 (Gene_ID) P27037-1/G7PKJ4 (A20-P134) (Accession)

Molecular Weight

Approximately 29-37 kDa

References & Citations

[1]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[2]V K Chin, et al. Inhibition of Activin A suppressed tumor necrosis factor-α secretion and improved histopathological conditions in malarial mice. Trop Biomed. 2021 Mar 1;38 (1) :187-204.|[3]Szabina Szófia Szilágyi, et al. Competition between type I activin and BMP receptors for binding to ACVR2A regulates signaling to distinct Smad pathways. BMC Biol. 2022 Feb 18;20 (1) :50.|[4]Heather L Hayes, et al. A Pdx-1-Regulated Soluble Factor Activates Rat and Human Islet Cell Proliferation. Mol Cell Biol. 2016 Nov 14;36 (23) :2918-2930.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TNP2 shRNA (UAS) - Lentiviral human TNP2 shRNA (UAS, iRFP) (100)
GTR15307854 1 Vial

Lentiviral human TNP2 shRNA (UAS) - Lentiviral human TNP2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
((4'-Chloro-[1,1'-biphenyl]-4-yl) sulfonyl) phenylalanine
HY-W030573 1 Each

((4'-Chloro-[1,1'-biphenyl]-4-yl) sulfonyl) phenylalanine

Sign In for Pricing
View Details
TSI-01
T895525 10 mg

TSI-01

Sign In for Pricing
View Details
KIF13B Rabbit Polyclonal Antibody
TA334698 100 µL

KIF13B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM115B 3'UTR Lenti-reporter-Luc Vector
19723081 1.0 µg

FAM115B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CACYBP siRNA (Mouse)
MBS8220658-01 15 nmol

CACYBP siRNA (Mouse)

Sign In for Pricing
View Details