Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dbi

UniProt

P31786

Expression Region

1-87aa (K33A)

Organism

Mus musculus

Target Sequence

MSQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFAQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Field of Research

Metabolism

Assay Type

Developed Protein

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine Suppressor of tumorigenicity 7 protein,ST7 ELISA KIT
ELI-39533p 96 Tests

Porcine Suppressor of tumorigenicity 7 protein,ST7 ELISA KIT

Ask
View Details
ILF2, NT (ILF2, NF45, Interleukin enhancer-binding factor 2, Nuclear factor of activated T-cells 45kD) (MaxLight 750)
MBS6310320-01 0.1 mL

ILF2, NT (ILF2, NF45, Interleukin enhancer-binding factor 2, Nuclear factor of activated T-cells 45kD) (MaxLight 750)

Ask
View Details
ILF2, NT (ILF2, NF45, Interleukin enhancer-binding factor 2, Nuclear factor of activated T-cells 45kD) (MaxLight 750)
MBS6310320-02 5x 0.1 mL

ILF2, NT (ILF2, NF45, Interleukin enhancer-binding factor 2, Nuclear factor of activated T-cells 45kD) (MaxLight 750)

Ask
View Details
Xpress™ Human DHX16 Over-expressing Stable Cell Line
ABC-X0856 1 Vial

Xpress™ Human DHX16 Over-expressing Stable Cell Line

Ask
View Details
Psmc1 Mouse shRNA Lentiviral Particle (Locus ID 19179)
TL501764V 500 µL Each

Psmc1 Mouse shRNA Lentiviral Particle (Locus ID 19179)

Ask
View Details
Recombinant Bacillus cereus UPF0637 protein BCA_4065 (BCA_4065)
MBS1016713-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus UPF0637 protein BCA_4065 (BCA_4065)

Ask
View Details