Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dbi

UniProt

P31786

Expression Region

1-87aa (K33A)

Organism

Mus musculus

Target Sequence

MSQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFAQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Field of Research

Metabolism

Assay Type

Developed Protein

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IL-1a (ALF-161) In Vivo Antibody - Low Endotoxin
ICH1099-50mg 50 mg

Anti-Mouse IL-1a (ALF-161) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS640704 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
RNF214 Human Gene Knockout Kit (CRISPR)
KN419941 1 Kit

RNF214 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-(5-Chloro-2-hydroxyphenyl)-2,2,2-trifluoroethanone
TRC-C367715-50MG 50 mg

1-(5-Chloro-2-hydroxyphenyl)-2,2,2-trifluoroethanone

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL
BNC400696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL
BNC040007-500 1x 500 µL

Cyclin D1 (DCS-6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details