Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PODXL, Human (P.pastoris, His)

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PODXL Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/podxl-protein-human-p-pastoris-his.html

Purity

93.00

Smiles

QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF

Molecular Formula

5420 (Gene_ID) O00592-1 (Q32-F458) (Accession)

Molecular Weight

Approximately 120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O157:H7 YJBE Polyclonal Antibody
MBS7163976 Inquire

Rabbit anti-Escherichia coli O157:H7 YJBE Polyclonal Antibody

Sign In for Pricing
View Details
Stat2, phosphorylated (Tyr689) (Signal Transducer and Activator of Transcription 2) discontinued
S7969-83G 100 µg

Stat2, phosphorylated (Tyr689) (Signal Transducer and Activator of Transcription 2) discontinued

Sign In for Pricing
View Details
GLC3C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV726733 1.0 µg DNA

GLC3C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
ZYX Protein Vector (Mouse) (pPB-C-His)
PV251218 500 ng

ZYX Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ERG antibody
70R-12510 100 µL

ERG antibody

Sign In for Pricing
View Details
ELISA Kit for Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13)
TRV-0037658-01 24 Tests

ELISA Kit for Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13)

Sign In for Pricing
View Details