Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAV1 (salvador Homolog 1 (Drosophila), SAV, WW45, WWP4) (PE)
251437-PE 100 µL

SAV1 (salvador Homolog 1 (Drosophila), SAV, WW45, WWP4) (PE)

Sign In for Pricing
View Details
FAM105B cDNA Clone
MBS1271461-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

FAM105B cDNA Clone

Sign In for Pricing
View Details
FAM105B cDNA Clone
MBS1271461-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

FAM105B cDNA Clone

Sign In for Pricing
View Details
Proliferating Bovine Pulmonary Artery Endothelial Cells (BPAEC)
B303-96W 96 Well

Proliferating Bovine Pulmonary Artery Endothelial Cells (BPAEC)

Sign In for Pricing
View Details
ZNF385A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2702706 1.0 µg DNA

ZNF385A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CHRNA1 Polyclonal Antibody
MBS8568025-01 0.1 mL

CHRNA1 Polyclonal Antibody

Sign In for Pricing
View Details