Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD1a Antibody / Rabbit Monoclonal
V7231SAF-100UG 100 µg

Recombinant CD1a Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details
Limonin
164756 5 mg

Limonin

Sign In for Pricing
View Details
Mouse EP300 (E1A Binding Protein P300) ELISA Kit
ELK6841-01 48 Tests

Mouse EP300 (E1A Binding Protein P300) ELISA Kit

Sign In for Pricing
View Details
Mouse EP300 (E1A Binding Protein P300) ELISA Kit
ELK6841-02 96 Tests

Mouse EP300 (E1A Binding Protein P300) ELISA Kit

Sign In for Pricing
View Details
Mouse EP300 (E1A Binding Protein P300) ELISA Kit
ELK6841-03 5x 96 Tests

Mouse EP300 (E1A Binding Protein P300) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) MURC Polyclonal Antibody
MBS7174158 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) MURC Polyclonal Antibody

Sign In for Pricing
View Details