Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT7 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV680190 1.0 µg DNA

PRMT7 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Monoclonal MZF1 Antibody (PCRP-MZF1-1E8) [Janelia Fluor 525]
NBP3-24013JF525 0.1 mL

Mouse Monoclonal MZF1 Antibody (PCRP-MZF1-1E8) [Janelia Fluor 525]

Sign In for Pricing
View Details
AXUD1 (Cysteine/Serine-rich Nuclear Protein 1, CSRNP-1, Axin-1 Up-regulated Gene 1 Protein, Protein URAX1, TGF-beta-induced Apoptosis Protein 3, TAIP-3, CSRNP1, TAIP3) (MaxLight 490)
137556-ML490 100 µL

AXUD1 (Cysteine/Serine-rich Nuclear Protein 1, CSRNP-1, Axin-1 Up-regulated Gene 1 Protein, Protein URAX1, TGF-beta-induced Apoptosis Protein 3, TAIP-3, CSRNP1, TAIP3) (MaxLight 490)

Sign In for Pricing
View Details
CASP9 Rabbit Monoclonal Antibody [Clone ID: 24GB4285]
TA424599 100 µL

CASP9 Rabbit Monoclonal Antibody [Clone ID: 24GB4285]

Sign In for Pricing
View Details
BIX02189
MBS3846154-01 5 mg

BIX02189

Sign In for Pricing
View Details
BIX02189
MBS3846154-02 10 mg

BIX02189

Sign In for Pricing
View Details