Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal DHX58 Antibody [DyLight 405]
NBP1-76390V 0.1 mL

Rabbit Polyclonal DHX58 Antibody [DyLight 405]

Ask
View Details
Mouse Monoclonal ROMO1 Antibody (OTI2C12) [DyLight 550]
NBP2-73928R 0.1 mL

Mouse Monoclonal ROMO1 Antibody (OTI2C12) [DyLight 550]

Ask
View Details
ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)
MBS6236236-01 0.1 mL

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)

Ask
View Details
ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)
MBS6236236-02 5x 0.1 mL

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)

Ask
View Details
NDUFA1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62676R-BF405 100 µL

NDUFA1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details