Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (AP) discontinued
031940-AP 200 µL

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (AP) discontinued

Ask
View Details
AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (Biotin)
123181-Biotin 100 µL

AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (Biotin)

Ask
View Details
Rabbit Monoclonal Survivin Antibody (BIRC5/8936R) [mFluor Violet 500 SE]
NBP3-24238MFV500 0.1 mL

Rabbit Monoclonal Survivin Antibody (BIRC5/8936R) [mFluor Violet 500 SE]

Ask
View Details
(PEO) 3-Mono-amine 99+% (GC)
241195-01 250 mg

(PEO) 3-Mono-amine 99+% (GC)

Ask
View Details
(PEO) 3-Mono-amine 99+% (GC)
241195-02 1 g

(PEO) 3-Mono-amine 99+% (GC)

Ask
View Details
(PEO) 3-Mono-amine 99+% (GC)
241195-03 5 g

(PEO) 3-Mono-amine 99+% (GC)

Ask
View Details