Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His, solution)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-calr-protein-mouse-p-pastoris-his-solution.html

Purity

90.0

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MPP6 (MPHOSPH6) (NM_005792) Human Over-expression Lysate
LC417078 20 µg

MPP6 (MPHOSPH6) (NM_005792) Human Over-expression Lysate

Ask
View Details
ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (PE)
MBS6475098-01 0.2 mL

ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (PE)

Ask
View Details
ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (PE)
MBS6475098-02 5x 0.2 mL

ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (PE)

Ask
View Details
MTBP (MDM2-Binding Protein, Murine Double Minute-2 BP) (MaxLight 490) discontinued
M4692-85-ML490 100 µL

MTBP (MDM2-Binding Protein, Murine Double Minute-2 BP) (MaxLight 490) discontinued

Ask
View Details
HOMER1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07890 0.1 mg

HOMER1 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Bacitracin B2 EvoPure® - currently unavailable
B017-2MG 2 mg

Bacitracin B2 EvoPure® - currently unavailable

Ask
View Details