Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC4, Human (HEK293, His)

The TXNDC4 protein is critical in cellular processes, mediating thiol-dependent retention in the early secretory pathway.Its conserved CRFS motif forms mixed disulfide bonds with substrate proteins to control oxidative protein folding in the endoplasmic reticulum and maintain cellular redox balance.TXNDC4 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc4-protein-human-hek-293-his.html

Smiles

EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRD

Molecular Formula

23071 (Gene_ID) Q9BS26 (E30-D402) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF740 conjugate, 0.1mg/mL
BNC740396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (NKI-C3), CF740 conjugate, 0.1mg/mL
BNC740186-100 1x 100 µL

CD63 (NKI-C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details