Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCN1/Lipocalin-1, Human (HEK293, His)

The LCN1/Lipocalin-1 protein may be involved in taste reception and contribute to the concentration and transport of taste molecules in the taste system. LCN1/Lipocalin-1 Protein, Human (HEK293, His) is the recombinant human-derived LCN1/Lipocalin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LCN1/Lipocalin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lcn1-lipocalin-1-protein-human-hek293-his.html

Purity

98.0

Smiles

HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Molecular Formula

3933 (Gene_ID) P31025 (H19-D176) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human MAG Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200UL
IRBAMLMAGAP03200UL 200 µL

Rabbit Anti Human MAG Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200UL

Sign In for Pricing
View Details
RPL14 antibody
70R-19966 50 ul

RPL14 antibody

Sign In for Pricing
View Details
Usp43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3590807 1.0 µg DNA

Usp43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)
MBS2569403-01 0.01 mg

Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)
MBS2569403-02 0.05 mg

Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)
MBS2569403-03 5x 0.05 mg

Recombinant Rhesus Macaque Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-6His)

Sign In for Pricing
View Details