Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGI-1776

SGI-1776 is a potent, selective, orally active Pim kinase inhibitor with IC50 of 7, 363 and 69 nM for Pim1, Pim2 and Pim3, respectively; exhibits promising selectivity against a panel of >300 kinases, shows inhibitory activity against two other kinases: Flt-3 (IC50=44 nM) and Haspin (IC50=34 nM) ; reduces cell viability of androgen-independent prostate cancer cell lines with IC50 of 2-4 uM, causes cell cycle arrest and caspase-dependent apoptosis in prostate cancer cells, marginally sensitizes prostate cancer cells to taxane-based therapeutics by inhibiting MDR1 activity and inducing apoptosis; shows efficacy in xenograft model bearing MV-4-11 tumors.Prostate Cancer Phase 1 Clinical.

Product Specifications

CAS Number

1025065-69-3

Product Name Alternative

SGI 1776 | SGI1776

Purity

>98% (HPLC)

Solubility

10 mM in DMSO

Smiles

FC (F) (F) OC1=CC=C (C2=CN=C3C=CC (NCC4CCN (C) CC4) =NN32) C=C1

Molecular Formula

C20H22F3N5O

Molecular Weight

405.42

Storage Conditions

Storage temperature: -20°C. Stability: ≥ 2 years

Notes

For research use only.

Other Product Names

Imidazo[1,2-b]pyridazin-6-amine, N-[ (1-methyl-4-piperidinyl) methyl]-3-[3- (trifluoromethoxy) phenyl]-

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Complement Receptor 2 (CD21) Polyclonal Antibody
TRV-0020182-01 50 Tests

Anti-Complement Receptor 2 (CD21) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Complement Receptor 2 (CD21) Polyclonal Antibody
TRV-0020182-02 100 Tests

Anti-Complement Receptor 2 (CD21) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Complement Receptor 2 (CD21) Polyclonal Antibody
TRV-0020182-03 200 Tests

Anti-Complement Receptor 2 (CD21) Polyclonal Antibody

Sign In for Pricing
View Details
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
T75860-01 5 mg

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
T75860-02 50 mg

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Talin (TLN, Talin 1, Talin-1, TLN1, ILWEQ, KIAA1027) (Biotin)
T0750-02A-Biotin 100 µL

Talin (TLN, Talin 1, Talin-1, TLN1, ILWEQ, KIAA1027) (Biotin)

Sign In for Pricing
View Details